Lineage for d1dt1a_ (1dt1 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980705Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980706Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1980707Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1980806Protein Cytochrome c552 [46636] (6 species)
  7. 1980866Species Thermus thermophilus [TaxId:274] [46637] (7 PDB entries)
    Uniprot P04164
  8. 1980870Domain d1dt1a_: 1dt1 A: [15811]
    complexed with hem

Details for d1dt1a_

PDB Entry: 1dt1 (more details), 1.8 Å

PDB Description: thermus thermophilus cytochrome c552 synthesized by escherichia coli
PDB Compounds: (A:) cytochrome c552

SCOPe Domain Sequences for d1dt1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dt1a_ a.3.1.1 (A:) Cytochrome c552 {Thermus thermophilus [TaxId: 274]}
dgakiyaqcagchqqngqgipgafpplaghvaeilakeggreylilvllyglqgqievkg
mkyngvmssfaqlkdeeiaavlnhiatawgdakkvkgfkpftaeevkklrakkltpqqvl
aerkklglk

SCOPe Domain Coordinates for d1dt1a_:

Click to download the PDB-style file with coordinates for d1dt1a_.
(The format of our PDB-style files is described here.)

Timeline for d1dt1a_: