Class a: All alpha proteins [46456] (289 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein Cytochrome c552 [46636] (6 species) |
Species Thermus thermophilus [TaxId:274] [46637] (7 PDB entries) Uniprot P04164 |
Domain d1dt1a_: 1dt1 A: [15811] complexed with hem |
PDB Entry: 1dt1 (more details), 1.8 Å
SCOPe Domain Sequences for d1dt1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dt1a_ a.3.1.1 (A:) Cytochrome c552 {Thermus thermophilus [TaxId: 274]} dgakiyaqcagchqqngqgipgafpplaghvaeilakeggreylilvllyglqgqievkg mkyngvmssfaqlkdeeiaavlnhiatawgdakkvkgfkpftaeevkklrakkltpqqvl aerkklglk
Timeline for d1dt1a_: