Lineage for d3ecka1 (3eck A:4-147)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942540Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 2942671Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species)
  7. 2942685Species Brevibacterium fuscum [TaxId:47914] [89888] (17 PDB entries)
  8. 2942718Domain d3ecka1: 3eck A:4-147 [158108]
    automatically matched to d1f1xa1
    complexed with ca, cl, fe2, gol, xxg

Details for d3ecka1

PDB Entry: 3eck (more details), 1.6 Å

PDB Description: structure of e323l homoprotocatechuate 2,3-dioxygenase from brevibacterium fuscum in complex with putative o-o bond cleavage intermediate formed via in crystallo reaction with 4-sulfonyl catechol at low oxygen concentrations
PDB Compounds: (A:) PROTEIN (Homoprotocatechuate 2,3-dioxygenase)

SCOPe Domain Sequences for d3ecka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ecka1 d.32.1.3 (A:4-147) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum [TaxId: 47914]}
eipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefihhn
lvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrvedplg
fpyefffetthverlhmrydlysa

SCOPe Domain Coordinates for d3ecka1:

Click to download the PDB-style file with coordinates for d3ecka1.
(The format of our PDB-style files is described here.)

Timeline for d3ecka1: