SCOPe 2.05: Domain d3ecjb2: 3ecj B:148-322

Lineage for d3ecjb2 (3ecj B:148-322)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species)

7. Species Brevibacterium fuscum [TaxId:47914] [89888] (15 PDB entries)

8. Domain d3ecjb2: 3ecj B:148-322 [158103]
   automatically matched to d1f1xa2
   complexed with ca, cl, fe2, gol; mutant

Details for d3ecjb2

PDB Entry: 3ecj, 1.65 Å

PDB Description: structure of e323l mutant of homoprotocatechuate 2,3-dioxygenase from brevibacterium fuscum at 1.65a resolution

PDB Compounds: (B:) PROTEIN (Homoprotocatechuate 2,3-dioxygenase)

SCOPe Domain Sequences for d3ecjb2:

Sequence; same for both SEQRES and ATOM records:

>d3ecjb2 d.32.1.3 (B:148-322) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum [TaxId: 47914]}
gelvrldhfnqvtpdvprgrkyledlgfrvtediqddegttyaawmhrkgtvhdtaltgg
ngprlhhvafsthekhniiqicdkmgalrisdriergpgrhgvsnafylyildpdnhrie
iytqdyytgdpdnptitwnvhdnqrrdwwgnpvvpswyteaskvldldgnvqeii

Timeline for d3ecjb2:

• d3ecjb2 first appeared in SCOP 1.75
  
• d3ecjb2 appears in SCOPe 2.04
  
• d3ecjb2 appears in SCOPe 2.06
  
• d3ecjb2 appears in the current release, SCOPe 2.08