Lineage for d1c52__ (1c52 -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily) Superfamily a.3.1: Cytochrome c [46626] (5 families) 
Family a.3.1.1: monodomain cytochrome c [46627] (11 proteins) 
Protein Cytochrome c552 [46636] (5 species) Species Thermus thermophilus [TaxId:274] [46637] (3 PDB entries) 
Domain d1c52__: 1c52 - [15810]
Details for d1c52__
PDB Entry: 1c52 (more details), 1.28 Å
PDB Description: thermus thermophilus cytochrome-c552: a new highly thermostable cytochrome-c structure obtained by mad phasing
SCOP Domain Sequences for d1c52__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c52__ a.3.1.1 (-) Cytochrome c552 {Thermus thermophilus}
qadgakiyaqcagchqqngqgipgafpplaghvaeilakeggreylilvllyglqgqiev
kgmkyngvmssfaqlkdeeiaavlnhiatawgdakkvkgfkpftaeevkklrakkltpqq
vlaerkklglk
SCOP Domain Coordinates for d1c52__:
Click to download the PDB-style file with coordinates for d1c52__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c52__:
- d1c52__ first appeared (with stable ids) in SCOP 1.55
- d1c52__ appears in SCOP 1.59
- d1c52__ appears in the current release, SCOPe 2.08, called d1c52a_
View in 3D