![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein Cytochrome c552 [46636] (6 species) |
![]() | Species Thermus thermophilus [TaxId:274] [46637] (7 PDB entries) Uniprot P04164 |
![]() | Domain d1c52a_: 1c52 A: [15810] complexed with hem |
PDB Entry: 1c52 (more details), 1.28 Å
SCOPe Domain Sequences for d1c52a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c52a_ a.3.1.1 (A:) Cytochrome c552 {Thermus thermophilus [TaxId: 274]} qadgakiyaqcagchqqngqgipgafpplaghvaeilakeggreylilvllyglqgqiev kgmkyngvmssfaqlkdeeiaavlnhiatawgdakkvkgfkpftaeevkklrakkltpqq vlaerkklglk
Timeline for d1c52a_: