| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
| Protein Cytochrome c552 [46636] (6 species) |
| Species Thermus thermophilus [TaxId:274] [46637] (7 PDB entries) Uniprot P04164 |
| Domain d1c52a_: 1c52 A: [15810] complexed with hem |
PDB Entry: 1c52 (more details), 1.28 Å
SCOPe Domain Sequences for d1c52a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c52a_ a.3.1.1 (A:) Cytochrome c552 {Thermus thermophilus [TaxId: 274]}
qadgakiyaqcagchqqngqgipgafpplaghvaeilakeggreylilvllyglqgqiev
kgmkyngvmssfaqlkdeeiaavlnhiatawgdakkvkgfkpftaeevkklrakkltpqq
vlaerkklglk
Timeline for d1c52a_: