SCOPe 2.05: Domain d3ec9b_: 3ec9 B:

Lineage for d3ec9b_ (3ec9 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.10: PhzA/PhzB-like [102813] (4 proteins)

6. Protein Uncharacterized protein BTHI0051 [159973] (1 species)

7. Species Burkholderia thailandensis [TaxId:57975] [159974] (1 PDB entry)
   Uniprot Q2T2I4 10-139

8. Domain d3ec9b_: 3ec9 B: [158093]
   automated match to d3ec9a1
   complexed with act, gol

Details for d3ec9b_

PDB Entry: 3ec9, 1.6 Å

PDB Description: crystal structure of a ntf2-like protein (bth_i0051) from burkholderia thailandensis e264 at 1.60 a resolution

PDB Compounds: (B:) uncharacterized NTF2-like protein

SCOPe Domain Sequences for d3ec9b_:

Sequence; same for both SEQRES and ATOM records:

>d3ec9b_ d.17.4.10 (B:) Uncharacterized protein BTHI0051 {Burkholderia thailandensis [TaxId: 57975]}
mmrtpyqivadhyaasdrhdpaammadiapaiewtemagfpcagtyrsadeivrnvfrrl
geewdgytfkldalhdagdtvigvgrysgtyrrtgksfecrvahvwrvdagkivhfeqft
dtllvaqamqp

Timeline for d3ec9b_:

• d3ec9b_ first appeared in SCOP 1.75, called d3ec9b1
  
• d3ec9b_ appears in SCOPe 2.04
  
• d3ec9b_ appears in SCOPe 2.06
  
• d3ec9b_ appears in the current release, SCOPe 2.08