SCOP 1.75: Domain d3ec0b1: 3ec0 B:101-199

Lineage for d3ec0b1 (3ec0 B:101-199)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (3 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 2 (HIV-2) protease [50634] (1 species)

7. Species Human immunodeficiency virus type 2 [TaxId:11709] [50635] (18 PDB entries)

8. Domain d3ec0b1: 3ec0 B:101-199 [158091]
   automatically matched to d1hiia_
   complexed with cl, grl, imd, na, zn

Details for d3ec0b1

PDB Entry: 3ec0, 1.18 Å

PDB Description: High Resolution HIV-2 Protease Structure in Complex with Antiviral Inhibitor GRL-06579A

PDB Compounds: (B:) Protease

SCOP Domain Sequences for d3ec0b1:

Sequence; same for both SEQRES and ATOM records:

>d3ec0b1 b.50.1.1 (B:101-199) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2 [TaxId: 11709]}
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl

Timeline for d3ec0b1:

• d3ec0b1 is new in SCOP 1.75
  
• d3ec0b1 is called d3ec0b_ in SCOPe 2.01
  
• d3ec0b1 appears in the current release, SCOPe 2.08, called d3ec0b_