Class b: All beta proteins [48724] (174 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (3 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein Human immunodeficiency virus type 2 (HIV-2) protease [50634] (1 species) |
Species Human immunodeficiency virus type 2 [TaxId:11709] [50635] (18 PDB entries) |
Domain d3ec0b1: 3ec0 B:101-199 [158091] automatically matched to d1hiia_ complexed with cl, grl, imd, na, zn |
PDB Entry: 3ec0 (more details), 1.18 Å
SCOP Domain Sequences for d3ec0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ec0b1 b.50.1.1 (B:101-199) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2 [TaxId: 11709]} pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk nveievlnkkvratimtgdtpinifgrniltalgmslnl
Timeline for d3ec0b1: