Lineage for d1c6ob_ (1c6o B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303644Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2303645Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2303646Family a.3.1.1: monodomain cytochrome c [46627] (16 protein domains)
  6. 2303819Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (10 species)
  7. 2303846Species Green alga (Scenedesmus obliquus) [TaxId:3088] [46635] (2 PDB entries)
  8. 2303849Domain d1c6ob_: 1c6o B: [15809]
    complexed with hem

Details for d1c6ob_

PDB Entry: 1c6o (more details), 2 Å

PDB Description: crystal structure of oxidized cytochrome c6 from the green algae scenedesmus obliquus
PDB Compounds: (B:) cytochrome c6

SCOPe Domain Sequences for d1c6ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c6ob_ a.3.1.1 (B:) Cytochrome c6 (synonym: cytochrome c553) {Green alga (Scenedesmus obliquus) [TaxId: 3088]}
sadlalgkqtfeancaachaggnnsvipdhtlrkaameqflqggfnleaityqvengkga
mpawsgtldddeiaavaayvydqasgdkw

SCOPe Domain Coordinates for d1c6ob_:

Click to download the PDB-style file with coordinates for d1c6ob_.
(The format of our PDB-style files is described here.)

Timeline for d1c6ob_: