![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (11 species) |
![]() | Species Green alga (Scenedesmus obliquus) [TaxId:3088] [46635] (2 PDB entries) |
![]() | Domain d1c6ob_: 1c6o B: [15809] complexed with hem |
PDB Entry: 1c6o (more details), 2 Å
SCOPe Domain Sequences for d1c6ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c6ob_ a.3.1.1 (B:) Cytochrome c6 (synonym: cytochrome c553) {Green alga (Scenedesmus obliquus) [TaxId: 3088]} sadlalgkqtfeancaachaggnnsvipdhtlrkaameqflqggfnleaityqvengkga mpawsgtldddeiaavaayvydqasgdkw
Timeline for d1c6ob_: