SCOPe 2.08: Domain d3ebzb_: 3ebz B:

Lineage for d3ebzb_ (3ebz B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 2 (HIV-2) protease [50634] (2 species)

7. Species Human immunodeficiency virus type 2 (isolate rod) [TaxId:11720] [187235] (3 PDB entries)

8. Domain d3ebzb_: 3ebz B: [158089]
   automated match to d1hiia_
   complexed with 017, cl, imd, na, zn

Details for d3ebzb_

PDB Entry: 3ebz, 1.2 Å

PDB Description: High Resolution HIV-2 Protease Structure in Complex with Clinical Drug Darunavir

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d3ebzb_:

Sequence; same for both SEQRES and ATOM records:

>d3ebzb_ b.50.1.1 (B:) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2 (isolate rod) [TaxId: 11720]}
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl

Timeline for d3ebzb_:

• d3ebzb_ first appeared in SCOP 1.75, called d3ebzb1
  
• d3ebzb_ appears in SCOPe 2.07