Lineage for d3ebya1 (3eby A:6-162)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1896198Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1896464Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 1896514Protein Putative hydroxylase subunit Saro3860 [159980] (1 species)
  7. 1896515Species Novosphingobium aromaticivorans [TaxId:48935] [159981] (1 PDB entry)
    Uniprot A4XDU4 6-162
  8. 1896516Domain d3ebya1: 3eby A:6-162 [158087]
    complexed with cl

Details for d3ebya1

PDB Entry: 3eby (more details), 1.75 Å

PDB Description: crystal structure of the beta subunit of a putative aromatic-ring- hydroxylating dioxygenase (yp_001165631.1) from novosphingobium aromaticivorans dsm 12444 at 1.75 a resolution
PDB Compounds: (A:) beta subunit of a putative Aromatic-ring-hydroxylating dioxygenase

SCOPe Domain Sequences for d3ebya1:

Sequence, based on SEQRES records: (download)

>d3ebya1 d.17.4.4 (A:6-162) Putative hydroxylase subunit Saro3860 {Novosphingobium aromaticivorans [TaxId: 48935]}
evaqvaqsaiddfnaayglcldddrleqwptlfvddclyqviarenvdnglpaavmycds
kgmladrvvalrkanvfpehfnrhligravitgvegdqvsaeasyvvfqtrndgetriyn
agkyvdrfdlsggtvrlksrtciydtlriatllatpi

Sequence, based on observed residues (ATOM records): (download)

>d3ebya1 d.17.4.4 (A:6-162) Putative hydroxylase subunit Saro3860 {Novosphingobium aromaticivorans [TaxId: 48935]}
evaqvaqsaiddfnaayglcldddrleqwptlfvddclyqviarenvdnglpaavmycds
kgmladrvvalrkanhfnrhligravitgvegdqvsaeasyvvfqtrndgetriynagky
vdrfdlsggtvrlksrtciydtlriatllatpi

SCOPe Domain Coordinates for d3ebya1:

Click to download the PDB-style file with coordinates for d3ebya1.
(The format of our PDB-style files is described here.)

Timeline for d3ebya1: