SCOPe 2.06: Domain d3ebta1: 3ebt A:1-131

Lineage for d3ebta1 (3ebt A:1-131)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.9: SnoaL-like polyketide cyclase [102810] (6 proteins)

6. Protein Uncharacterized protein BPSS0132 [159971] (1 species)

7. Species Burkholderia pseudomallei [TaxId:28450] [159972] (1 PDB entry)
   Uniprot Q63P16 1-131

8. Domain d3ebta1: 3ebt A:1-131 [158086]
   Other proteins in same PDB: d3ebta2
   complexed with unl

Details for d3ebta1

PDB Entry: 3ebt, 1.3 Å

PDB Description: crystal structure of a ntf2-like protein of unknown function (bpss0132) from burkholderia pseudomallei k96243 at 1.30 a resolution

PDB Compounds: (A:) uncharacterized NTF2-like protein

SCOPe Domain Sequences for d3ebta1:

Sequence; same for both SEQRES and ATOM records:

>d3ebta1 d.17.4.9 (A:1-131) Uncharacterized protein BPSS0132 {Burkholderia pseudomallei [TaxId: 28450]}
msnnmqtvresyeafhrrdlpgvlaalapdvrwthpdgmspyglggtkhghdeviafirh
vpthiaemrlapdefiesgerivvlgtrrvtavngrsatlkfvhvwrfengravtfedhf
dtaemirlita

Timeline for d3ebta1:

• d3ebta1 first appeared in SCOP 1.75
  
• d3ebta1 appears in SCOPe 2.05
  
• d3ebta1 appears in SCOPe 2.07
  
• d3ebta1 appears in the current release, SCOPe 2.08