| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily) unusual fold |
Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) ![]() |
| Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 protein domains) |
| Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [56515] (43 PDB entries) Uniprot P29477 77-496 ! Uniprot P29477 77-495 |
| Domain d3ebfa_: 3ebf A: [158084] automated match to d1jwja_ complexed with 332, h4b, hem, so4 |
| PDB Entry: 3ebf (more details) PDB Description: structure of inhibited murine inos oxygenase domain
PDB Compounds: (A:) Nitric oxide synthase, inducibleSCOP Domain Sequences for d3ebfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ebfa_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
n
SCOP Domain Coordinates for d3ebfa_:
Click to download the PDB-style file with coordinates for d3ebfa_. (The format of our PDB-style files is described here.)
Timeline for d3ebfa_:
d3ebfa_ appears in SCOP 1.75A | d3ebfa_ (click for larger image) d3ebfa_ in context of chain d3ebfa_ in context of PDB Domains from other chains: d3ebfb_ |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |