SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3ebfa_ (3ebf A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210107Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 2210108Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 2210109Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 protein domains)
  6. 2210110Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 2210316Species Mouse (Mus musculus) [TaxId:10090] [56515] (43 PDB entries)
    Uniprot P29477 77-496 ! Uniprot P29477 77-495
  8. 2210328Domain d3ebfa_: 3ebf A: [158084]
    automated match to d1jwja_
    complexed with 332, h4b, hem, so4

Details for d3ebfa_

PDB Entry: 3ebf (more details), 2.29 Å

PDB Description: Structure of inhibited murine iNOS oxygenase domain
PDB Compounds: (A:) Nitric oxide synthase, inducible

SCOPe Domain Sequences for d3ebfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ebfa_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
n

SCOPe Domain Coordinates for d3ebfa_:

Click to download the PDB-style file with coordinates for d3ebfa_.
(The format of our PDB-style files is described here.)

Timeline for d3ebfa_: