Lineage for d3ebda_ (3ebd A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2609056Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 2609057Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 2609058Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 2609059Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 2609373Species Mouse (Mus musculus) [TaxId:10090] [56515] (43 PDB entries)
    Uniprot P29477 77-496 ! Uniprot P29477 77-495
  8. 2609390Domain d3ebda_: 3ebd A: [158082]
    automated match to d1jwja_
    complexed with 329, h4b, hem, so4

Details for d3ebda_

PDB Entry: 3ebd (more details), 2.4 Å

PDB Description: Structure of inhibited murine iNOS oxygenase domain
PDB Compounds: (A:) Nitric oxide synthase, inducible

SCOPe Domain Sequences for d3ebda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ebda_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
n

SCOPe Domain Coordinates for d3ebda_:

Click to download the PDB-style file with coordinates for d3ebda_.
(The format of our PDB-style files is described here.)

Timeline for d3ebda_: