SCOPe 2.05: Domain d3ebda_: 3ebd A:

Lineage for d3ebda_ (3ebd A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)
   automatically mapped to Pfam PF02898

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [56515] (43 PDB entries)
   Uniprot P29477 77-496 ! Uniprot P29477 77-495

8. Domain d3ebda_: 3ebd A: [158082]
   automated match to d1jwja_
   complexed with 329, h4b, hem, so4

Details for d3ebda_

PDB Entry: 3ebd, 2.4 Å

PDB Description: Structure of inhibited murine iNOS oxygenase domain

PDB Compounds: (A:) Nitric oxide synthase, inducible

SCOPe Domain Sequences for d3ebda_:

Sequence; same for both SEQRES and ATOM records:

>d3ebda_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
n

Timeline for d3ebda_:

• d3ebda_ first appeared in SCOP 1.75, called d3ebda1
  
• d3ebda_ appears in SCOPe 2.04
  
• d3ebda_ appears in SCOPe 2.06
  
• d3ebda_ appears in the current release, SCOPe 2.08