Lineage for d3eb6b1 (3eb6 B:1-147)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1198735Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1198736Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1198737Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1198745Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1198746Species African clawed frog (Xenopus laevis) [TaxId:8355] [160080] (1 PDB entry)
  8. 1198747Domain d3eb6b1: 3eb6 B:1-147 [158081]
    automatically matched to d1ur6a_
    complexed with zn

Details for d3eb6b1

PDB Entry: 3eb6 (more details), 3.4 Å

PDB Description: Structure of the cIAP2 RING domain bound to UbcH5b
PDB Compounds: (B:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d3eb6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eb6b1 d.20.1.1 (B:1-147) Ubiquitin conjugating enzyme, UBC {African clawed frog (Xenopus laevis) [TaxId: 8355]}
malkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d3eb6b1:

Click to download the PDB-style file with coordinates for d3eb6b1.
(The format of our PDB-style files is described here.)

Timeline for d3eb6b1: