SCOPe 2.03: Domain d3eaua_: 3eau A:

Lineage for d3eaua_ (3eau A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein Voltage-dependent K+ channel beta subunit [51434] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [51435] (10 PDB entries)

8. Domain d3eaua_: 3eau A: [158080]
   automated match to d1exba_
   complexed with ndp, pdn

Details for d3eaua_

PDB Entry: 3eau, 1.82 Å

PDB Description: Voltage-dependent K+ channel beta subunit in complex with cortisone

PDB Compounds: (A:) Voltage-gated potassium channel subunit beta-2

SCOPe Domain Sequences for d3eaua_:

Sequence; same for both SEQRES and ATOM records:

>d3eaua_ c.1.7.1 (A:) Voltage-dependent K+ channel beta subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mlqfyrnlgksglrvsclglgtwvtfggqitdemaehlmtlaydnginlfdtaevyaagk
aevvlgniikkkgwrrsslvittkifwggkaeterglsrkhiieglkaslerlqleyvdv
vfanrpdpntpmeetvramthvinqgmamywgtsrwssmeimeaysvarqfnlippiceq
aeyhmfqrekvevqlpelfhkigvgamtwsplacgivsgkydsgippysraslkgyqwlk
dkilseegrrqqaklkelqaiaerlgctlpqlaiawclrnegvssvllgasnaeqlmeni
gaiqvlpklsssivheidsilgnkpys

Timeline for d3eaua_:

• d3eaua_ first appeared in SCOP 1.75, called d3eaua1
  
• d3eaua_ appears in SCOPe 2.02
  
• d3eaua_ appears in SCOPe 2.04
  
• d3eaua_ appears in the current release, SCOPe 2.08