Lineage for d1c6oa_ (1c6o A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45011Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 45012Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 45013Family a.3.1.1: monodomain cytochrome c [46627] (11 proteins)
  6. 45094Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (9 species)
  7. 45110Species Green alga (Scenedesmus obliquus) [TaxId:3088] [46635] (2 PDB entries)
  8. 45112Domain d1c6oa_: 1c6o A: [15808]

Details for d1c6oa_

PDB Entry: 1c6o (more details), 2 Å

PDB Description: crystal structure of oxidized cytochrome c6 from the green algae scenedesmus obliquus

SCOP Domain Sequences for d1c6oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c6oa_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Green alga (Scenedesmus obliquus)}
sadlalgkqtfeancaachaggnnsvipdhtlrkaameqflqggfnleaityqvengkga
mpawsgtldddeiaavaayvydqasgdkw

SCOP Domain Coordinates for d1c6oa_:

Click to download the PDB-style file with coordinates for d1c6oa_.
(The format of our PDB-style files is described here.)

Timeline for d1c6oa_: