| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily) unusual fold |
Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) ![]() |
| Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein) |
| Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [56515] (38 PDB entries) Uniprot P29477 77-496 Uniprot P29477 77-495 Uniprot P29477 77-496 ! Uniprot P29477 77-495 |
| Domain d3eaia1: 3eai A:77-497 [158078] automatically matched to d1m8da_ complexed with 328, h4b, hem, so4 |
| PDB Entry: 3eai (more details) PDB Description: structure of inhibited murine inos oxygenase domain
PDB Compounds: (A:) Nitric oxide synthase, inducibleSCOP Domain Sequences for d3eaia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eaia1 d.174.1.1 (A:77-497) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
n
SCOP Domain Coordinates for d3eaia1:
Click to download the PDB-style file with coordinates for d3eaia1. (The format of our PDB-style files is described here.)
Timeline for d3eaia1:
d3eaia1 is new in SCOP 1.75 | d3eaia1 (click for larger image) d3eaia1 in context of chain d3eaia1 in context of PDB Domains from other chains: d3eaib1 |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |