Lineage for d3eaia1 (3eai A:77-497)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 878765Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 878766Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
  5. 878767Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)
  6. 878768Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 878885Species Mouse (Mus musculus) [TaxId:10090] [56515] (38 PDB entries)
    Uniprot P29477 77-496
    Uniprot P29477 77-495
    Uniprot P29477 77-496 ! Uniprot P29477 77-495
  8. 878893Domain d3eaia1: 3eai A:77-497 [158078]
    automatically matched to d1m8da_
    complexed with 328, h4b, hem, so4

Details for d3eaia1

PDB Entry: 3eai (more details), 2.2 Å

PDB Description: Structure of inhibited murine iNOS oxygenase domain
PDB Compounds: (A:) Nitric oxide synthase, inducible

SCOP Domain Sequences for d3eaia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eaia1 d.174.1.1 (A:77-497) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
n

SCOP Domain Coordinates for d3eaia1:

Click to download the PDB-style file with coordinates for d3eaia1.
(The format of our PDB-style files is described here.)

Timeline for d3eaia1: