SCOPe: Structural Classification of Proteins — extended. Release 2.05 (February 2015, new entries added 2015-08-06)
Search SCOPe (example):

Lineage for d3eaia_ (3eai A:)

  1. Root: SCOPe 2.05
  2. 1878092Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1930673Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 1930674Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 1930675Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 protein domains)
  6. 1930676Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 1930882Species Mouse (Mus musculus) [TaxId:10090] [56515] (43 PDB entries)
    Uniprot P29477 77-496 ! Uniprot P29477 77-495
  8. 1930896Domain d3eaia_: 3eai A: [158078]
    automated match to d1jwja_
    complexed with 328, h4b, hem, so4

Details for d3eaia_

PDB Entry: 3eai (more details), 2.2 Å
PDB Description: Structure of inhibited murine iNOS oxygenase domain
PDB Compounds: (A:) Nitric oxide synthase, inducible

SCOPe Domain Sequences for d3eaia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eaia_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
n

SCOPe Domain Coordinates for d3eaia_:

Click to download the PDB-style file with coordinates for d3eaia_.
(The format of our PDB-style files is described here.)

Timeline for d3eaia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3eaib_


SCOPe Copyright © 1994-2015 The SCOP and SCOPe authors
scope@compbio.berkeley.edu