Lineage for d3ea5b_ (3ea5 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006450Protein automated matches [190070] (4 species)
    not a true protein
  7. 2006451Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187009] (3 PDB entries)
  8. 2006452Domain d3ea5b_: 3ea5 B: [158074]
    Other proteins in same PDB: d3ea5a_, d3ea5c_
    automated match to d2bkub1
    complexed with gdp, mg

Details for d3ea5b_

PDB Entry: 3ea5 (more details), 2.5 Å

PDB Description: Kap95p Binding Induces the Switch Loops of RanGDP to adopt the GTP-bound Conformation: Implications for Nuclear Import Complex Assembly Dynamics
PDB Compounds: (B:) Importin subunit beta-1

SCOPe Domain Sequences for d3ea5b_:

Sequence, based on SEQRES records: (download)

>d3ea5b_ a.118.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mstaefaqllensilspdqnirltsetqlkklsndnflqfaglssqvlidentklegril
aaltlknelvskdsvktqqfaqrwitqvspeaknqiktnaltalvsieprianaaaqlia
aiadielphgawpelmkimvdntgaeqpenvkrasllalgymcesadpqsqalvsssnni
liaivqgaqstetskavrlaalnaladslifiknnmeregernylmqvvceatqaediev
qaaafgclckimskyytfmkpymeqalyaltiatmkspndkvasmtvefwsticeeeidi
ayelaqfpqsplqsynfalssikdvvpnllnlltrqnedpedddwnvsmsagaclqlfaq
ncgnhilepvlefveqnitadnwrnreaavmafgsimdgpdkvqrtyyvhqalpsilnlm
ndqslqvkettawcigriadsvaesidpqqhlpgvvqacliglqdhpkvatncswtiinl
veqlaeatpspiynfypalvdgligaanridnefnarasafsalttmveyatdtvaetsa
sistfvmdklgqtmsvdenqltledaqslqelqsniltvlaavirkspssvepvadmlmg
lffrllekkdsafieddvfyaisalaaslgkgfekyletfspyllkalnqvdspvsitav
gfiadisnsleedfrrysdammnvlaqmisnpnarrelkpavlsvfgdiasnigadfipy
lndimalcvaaqntkpengtlealdyqikvleavldayvgivaglhdkpealfpyvgtif
qfiaqvaedpqlysedatsraavgligdiaamfpdgsikqfygqdwvidyikrtrsgqlf
sqatkdtarwareqqkrqlsl

Sequence, based on observed residues (ATOM records): (download)

>d3ea5b_ a.118.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mstaefaqllensilspdqnirltsetqlkklsndnflqfaglssqvlidentklegril
aaltlknelvskdsvktqqfaqrwitqvspeaknqiktnaltalvsieprianaaaqlia
aiadielphgawpelmkimvdntgaeqpenvkrasllalgymcesadpqsqvsssnnili
aivqgaqstetskavrlaalnaladslifiknnmeregernylmqvvceatqaedievqa
aafgclckimskyytfmkpymeqalyaltiatmkspndkvasmtvefwsticeeeidiay
elaqfpqsplqsynfalssikdvvpnllnlltrqnedpedddwnvsmsagaclqlfaqnc
gnhilepvlefveqnitadnwrnreaavmafgsimdgpdkvqrtyyvhqalpsilnlmnd
qslqvkettawcigriadsvaesidpqqhlpgvvqacliglqdhpkvatncswtiinlve
qlaeatpspiynfypalvdgligaanridnefnarasafsalttmveyatdtvaetsasi
stfvmdklgqtmsvdenqltledaqslqelqsniltvlaavirkspssvepvadmlmglf
frllekkdsafieddvfyaisalaaslgkgfekyletfspyllkalnqvdspvsitavgf
iadisnsleedfrrysdammnvlaqmisnpnarrelkpavlsvfgdiasnigadfipyln
dimalcvaaqntkpengtlealdyqikvleavldayvgivaglhdkpealfpyvgtifqf
iaqvaedpqlysedatsraavgligdiaamfpdgsikqfygqdwvidyikrtrsgqlfsq
atkdtarwareqqkrqlsl

SCOPe Domain Coordinates for d3ea5b_:

Click to download the PDB-style file with coordinates for d3ea5b_.
(The format of our PDB-style files is described here.)

Timeline for d3ea5b_: