Lineage for d3e99a1 (3e99 A:1-163)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936608Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 2936609Protein Benzoate 1,2-dioxygenase beta subunit BenB [159982] (1 species)
  7. 2936610Species Burkholderia mallei [TaxId:13373] [159983] (1 PDB entry)
    Uniprot Q62E64 1-163
  8. 2936611Domain d3e99a1: 3e99 A:1-163 [158067]
    complexed with act

Details for d3e99a1

PDB Entry: 3e99 (more details), 1.9 Å

PDB Description: crystal structure of the beta subunit of the benzoate 1,2-dioxygenase (benb, bmaa0186) from burkholderia mallei atcc 23344 at 1.90 a resolution
PDB Compounds: (A:) Benzoate 1,2-dioxygenase beta subunit

SCOPe Domain Sequences for d3e99a1:

Sequence, based on SEQRES records: (download)

>d3e99a1 d.17.4.4 (A:1-163) Benzoate 1,2-dioxygenase beta subunit BenB {Burkholderia mallei [TaxId: 13373]}
mktidladiqaflyresrllddkawdawldcyradavfwmpswddadalvtdpqreisli
yypnrqgledrvfrikterssatvpdtrtshnianveresadgdvhtvrfnwhtlsyryk
tvssyfgmsryaidfsgdapkivskyvvlkndyinqlidiyhi

Sequence, based on observed residues (ATOM records): (download)

>d3e99a1 d.17.4.4 (A:1-163) Benzoate 1,2-dioxygenase beta subunit BenB {Burkholderia mallei [TaxId: 13373]}
mktidladiqaflyresrllddkawdawldcyradavfwmpswddisliyypnrqgledr
vfrikterssatvpdtrtshnianveresadgdvhtvrfnwhtlsyryktvssyfgmsry
aidfsgdapkivskyvvlkndylidiyhi

SCOPe Domain Coordinates for d3e99a1:

Click to download the PDB-style file with coordinates for d3e99a1.
(The format of our PDB-style files is described here.)

Timeline for d3e99a1: