Lineage for d3e8db_ (3e8d B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2220373Protein Pkb kinase (Akt-2) [82791] (1 species)
    AGC group; RAC/Akt subfamily; serine/threonine kinase
  7. 2220374Species Human (Homo sapiens) [TaxId:9606] [82792] (16 PDB entries)
  8. 2220392Domain d3e8db_: 3e8d B: [158064]
    automated match to d1o6ka_
    complexed with g98

Details for d3e8db_

PDB Entry: 3e8d (more details), 2.7 Å

PDB Description: crystal structures of the kinase domain of akt2 in complex with atp- competitive inhibitors
PDB Compounds: (B:) rac-beta serine/threonine-protein kinase

SCOPe Domain Sequences for d3e8db_:

Sequence, based on SEQRES records: (download)

>d3e8db_ d.144.1.7 (B:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]}
kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
qsititppdrydslglleldqrthfpqfdysasir

Sequence, based on observed residues (ATOM records): (download)

>d3e8db_ d.144.1.7 (B:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]}
kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
qsiqrthfpqfdysasir

SCOPe Domain Coordinates for d3e8db_:

Click to download the PDB-style file with coordinates for d3e8db_.
(The format of our PDB-style files is described here.)

Timeline for d3e8db_: