Lineage for d1c6s__ (1c6s -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45011Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 45012Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 45013Family a.3.1.1: monodomain cytochrome c [46627] (11 proteins)
  6. 45094Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (9 species)
  7. 45103Species Cyanobacterium (Synechococcus elongatus) [TaxId:32046] [46634] (1 PDB entry)
  8. 45104Domain d1c6s__: 1c6s - [15806]

Details for d1c6s__

PDB Entry: 1c6s (more details)

PDB Description: the solution structure of cytochrome c6 from the thermophilic cyanobacterium synechococcus elongatus, nmr, 20 structures

SCOP Domain Sequences for d1c6s__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c6s__ a.3.1.1 (-) Cytochrome c6 (synonym: cytochrome c553) {Cyanobacterium (Synechococcus elongatus)}
adlangakvfsgncaachmgggnvvmanktlkkealeqfgmysedaiiyqvqhgknampa
fagrltdeqiqdvaayvldqaakgwag

SCOP Domain Coordinates for d1c6s__:

Click to download the PDB-style file with coordinates for d1c6s__.
(The format of our PDB-style files is described here.)

Timeline for d1c6s__: