Lineage for d3e87a_ (3e87 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1931148Protein Pkb kinase (Akt-2) [82791] (1 species)
    AGC group; RAC/Akt subfamily; serine/threonine kinase
  7. 1931149Species Human (Homo sapiens) [TaxId:9606] [82792] (16 PDB entries)
  8. 1931158Domain d3e87a_: 3e87 A: [158059]
    automated match to d1o6ka_
    complexed with g95

Details for d3e87a_

PDB Entry: 3e87 (more details), 2.3 Å

PDB Description: crystal structures of the kinase domain of akt2 in complex with atp- competitive inhibitors
PDB Compounds: (A:) rac-beta serine/threonine-protein kinase

SCOPe Domain Sequences for d3e87a_:

Sequence, based on SEQRES records: (download)

>d3e87a_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]}
kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
qsititppdrydslglleldqrthfpqfdysasir

Sequence, based on observed residues (ATOM records): (download)

>d3e87a_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]}
kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
qsititppqrthfpqfdysasir

SCOPe Domain Coordinates for d3e87a_:

Click to download the PDB-style file with coordinates for d3e87a_.
(The format of our PDB-style files is described here.)

Timeline for d3e87a_: