SCOPe 2.06: Domain d3e7ib_: 3e7i B:

Lineage for d3e7ib_ (3e7i B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)
   automatically mapped to Pfam PF02898

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [56515] (43 PDB entries)
   Uniprot P29477 77-496 ! Uniprot P29477 77-495

8. Domain d3e7ib_: 3e7i B: [158053]
   automated match to d1jwja_
   complexed with b2, h4b, hem, so4, zn

Details for d3e7ib_

PDB Entry: 3e7i, 2.9 Å

PDB Description: structure of murine inos oxygenase domain with inhibitor ar-c94864

PDB Compounds: (B:) Nitric oxide synthase, inducible

SCOPe Domain Sequences for d3e7ib_:

Sequence; same for both SEQRES and ATOM records:

>d3e7ib_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq

Timeline for d3e7ib_:

• d3e7ib_ first appeared in SCOP 1.75, called d3e7ib1
  
• d3e7ib_ appears in SCOPe 2.05
  
• d3e7ib_ appears in SCOPe 2.07
  
• d3e7ib_ appears in the current release, SCOPe 2.08