Lineage for d1cyja_ (1cyj A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2690984Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (11 species)
  7. 2691007Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [46633] (2 PDB entries)
  8. 2691009Domain d1cyja_: 1cyj A: [15805]
    complexed with cd, hec

Details for d1cyja_

PDB Entry: 1cyj (more details), 1.9 Å

PDB Description: cytochrome c6
PDB Compounds: (A:) cytochrome c6

SCOPe Domain Sequences for d1cyja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cyja_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
adlalgaqvfngncaachmggrnsvmpektldkaaleqyldggfkvesiiyqvengkgam
pawadrlseeeiqavaeyvfkqatdaawky

SCOPe Domain Coordinates for d1cyja_:

Click to download the PDB-style file with coordinates for d1cyja_.
(The format of our PDB-style files is described here.)

Timeline for d1cyja_: