![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily) unusual fold |
![]() | Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) ![]() |
![]() | Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins) |
![]() | Protein automated matches [190421] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187302] (2 PDB entries) |
![]() | Domain d3e7gb_: 3e7g B: [158049] automated match to d1jwja_ complexed with at2, h4b, hem, zn |
PDB Entry: 3e7g (more details), 2.2 Å
SCOPe Domain Sequences for d3e7gb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e7gb_ d.174.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellpq aiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcig riqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwna qliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfeip pdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrd fcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaes fmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwq d
Timeline for d3e7gb_: