Lineage for d3e6lb_ (3e6l B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3003148Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 3003149Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 3003150Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 3004094Protein automated matches [190421] (6 species)
    not a true protein
  7. 3004468Species Mouse (Mus musculus) [TaxId:10090] [187301] (7 PDB entries)
  8. 3004472Domain d3e6lb_: 3e6l B: [158041]
    automated match to d1jwja_
    complexed with a11, bog, h4b, hem, so4

Details for d3e6lb_

PDB Entry: 3e6l (more details), 2.3 Å

PDB Description: structure of murine inos oxygenase domain with inhibitor ar-c132283
PDB Compounds: (B:) Nitric oxide synthase, inducible

SCOPe Domain Sequences for d3e6lb_:

Sequence, based on SEQRES records: (download)

>d3e6lb_ d.174.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq

Sequence, based on observed residues (ATOM records): (download)

>d3e6lb_ d.174.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatssclgsimnpksltrgprdkptpleellphaiefinq
yygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqwsnl
qvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqliryag
yqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlvlev
tmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdtqry
nileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkhmqn
eyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq

SCOPe Domain Coordinates for d3e6lb_:

Click to download the PDB-style file with coordinates for d3e6lb_.
(The format of our PDB-style files is described here.)

Timeline for d3e6lb_: