Lineage for d1cyi__ (1cyi -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45011Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 45012Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 45013Family a.3.1.1: monodomain cytochrome c [46627] (11 proteins)
  6. 45094Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (9 species)
  7. 45100Species Chlamydomonas reinhardtii [TaxId:3055] [46633] (2 PDB entries)
  8. 45101Domain d1cyi__: 1cyi - [15804]

Details for d1cyi__

PDB Entry: 1cyi (more details), 1.9 Å

PDB Description: cytochrome c6

SCOP Domain Sequences for d1cyi__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cyi__ a.3.1.1 (-) Cytochrome c6 (synonym: cytochrome c553) {Chlamydomonas reinhardtii}
adlalgaqvfngncaachmggrnsvmpektldkaaleqyldggfkvesiiyqvengkgam
pawadrlseeeiqavaeyvfkqatdaawk

SCOP Domain Coordinates for d1cyi__:

Click to download the PDB-style file with coordinates for d1cyi__.
(The format of our PDB-style files is described here.)

Timeline for d1cyi__: