SCOPe 2.01: Domain d3e6cc1: 3e6c C:148-227

Lineage for d3e6cc1 (3e6c C:148-227)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.4: CAP C-terminal domain-like [46796] (8 proteins)

6. Protein Chlorophenol reduction protein CprK [158268] (2 species)

7. Species Desulfitobacterium hafniense [TaxId:49338] [158270] (3 PDB entries)
   Uniprot Q18R04 148-227! Uniprot Q18R04 148-229

8. Domain d3e6cc1: 3e6c C:148-227 [158038]
   Other proteins in same PDB: d3e6cc2
   automatically matched to 3E5U A:148-227
   protein/DNA complex; complexed with 3c4

Details for d3e6cc1

PDB Entry: 3e6c, 1.8 Å

PDB Description: cprk ocpa dna complex

PDB Compounds: (C:) Cyclic nucleotide-binding protein

SCOPe Domain Sequences for d3e6cc1:

Sequence; same for both SEQRES and ATOM records:

>d3e6cc1 a.4.5.4 (C:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]}
nptirilrlfyelcssqgkrvgdtyeitmplsqksigeitgvhhvtvsrvlaslkrenil
dkkknkiivynlgelkhlse

Timeline for d3e6cc1:

• d3e6cc1 first appeared in SCOP 1.75
  
• d3e6cc1 appears in SCOPe 2.02
  
• d3e6cc1 appears in the current release, SCOPe 2.08