Lineage for d3e66b1 (3e66 B:1833-2087)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 836757Superfamily c.55.3: Ribonuclease H-like [53098] (14 families) (S)
    consists of one domain of this fold
  5. 837355Family c.55.3.14: Prp8 beta-finger domain-like [159638] (1 protein)
  6. 837356Protein Pre-mRNA-splicing factor 8, Prp8 [159639] (2 species)
  7. 837361Species Saccharomyces cerevisiae [TaxId:4932] [159641] (3 PDB entries)
    Uniprot P33334 1833-2087! Uniprot P33334 1835-2087
  8. 837364Domain d3e66b1: 3e66 B:1833-2087 [158033]
    automatically matched to 3E66 A:1833-2087

Details for d3e66b1

PDB Entry: 3e66 (more details), 2.05 Å

PDB Description: Crystal structure of the beta-finger domain of yeast Prp8
PDB Compounds: (B:) prp8

SCOP Domain Sequences for d3e66b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e66b1 c.55.3.14 (B:1833-2087) Pre-mRNA-splicing factor 8, Prp8 {Saccharomyces cerevisiae [TaxId: 4932]}
pflnssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflk
iihtsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfp
niairptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlll
ralktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynvnis
altqteikdiilgqn

SCOP Domain Coordinates for d3e66b1:

Click to download the PDB-style file with coordinates for d3e66b1.
(The format of our PDB-style files is described here.)

Timeline for d3e66b1:

View in 3D
Domains from other chains:
(mouse over for more information)
d3e66a1