Lineage for d3e66b_ (3e66 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886992Family c.55.3.14: Prp8 beta-finger domain-like [159638] (1 protein)
    automatically mapped to Pfam PF12134
  6. 2886993Protein Pre-mRNA splicing factor 8, Prp8 / Spp42 [159639] (4 species)
  7. 2886994Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159641] (5 PDB entries)
    Uniprot P33334 1833-2087! Uniprot P33334 1835-2087
  8. 2886999Domain d3e66b_: 3e66 B: [158033]
    automated match to d3e66a1

Details for d3e66b_

PDB Entry: 3e66 (more details), 2.05 Å

PDB Description: Crystal structure of the beta-finger domain of yeast Prp8
PDB Compounds: (B:) prp8

SCOPe Domain Sequences for d3e66b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e66b_ c.55.3.14 (B:) Pre-mRNA splicing factor 8, Prp8 / Spp42 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pflnssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflk
iihtsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfp
niairptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlll
ralktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynvnis
altqteikdiilgqn

SCOPe Domain Coordinates for d3e66b_:

Click to download the PDB-style file with coordinates for d3e66b_.
(The format of our PDB-style files is described here.)

Timeline for d3e66b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3e66a1