Lineage for d3e66a1 (3e66 A:1833-2087)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2462855Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2463945Family c.55.3.14: Prp8 beta-finger domain-like [159638] (1 protein)
    automatically mapped to Pfam PF12134
  6. 2463946Protein Pre-mRNA splicing factor 8, Prp8 / Spp42 [159639] (4 species)
  7. 2463947Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159641] (5 PDB entries)
    Uniprot P33334 1833-2087! Uniprot P33334 1835-2087
  8. 2463951Domain d3e66a1: 3e66 A:1833-2087 [158032]

Details for d3e66a1

PDB Entry: 3e66 (more details), 2.05 Å

PDB Description: Crystal structure of the beta-finger domain of yeast Prp8
PDB Compounds: (A:) prp8

SCOPe Domain Sequences for d3e66a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e66a1 c.55.3.14 (A:1833-2087) Pre-mRNA splicing factor 8, Prp8 / Spp42 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pflnssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflk
iihtsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfp
niairptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlll
ralktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynvnis
altqteikdiilgqn

SCOPe Domain Coordinates for d3e66a1:

Click to download the PDB-style file with coordinates for d3e66a1.
(The format of our PDB-style files is described here.)

Timeline for d3e66a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d3e66b_