SCOP 1.75: Domain d3e65b1: 3e65 B:77-497

Lineage for d3e65b1 (3e65 B:77-497)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [56515] (38 PDB entries)
   Uniprot P29477 77-496
   Uniprot P29477 77-495
   Uniprot P29477 77-496 ! Uniprot P29477 77-495

8. Domain d3e65b1: 3e65 B:77-497 [158031]
   automatically matched to d1m8da_
   complexed with h4b, hem, xxz

Details for d3e65b1

PDB Entry: 3e65, 2.05 Å

PDB Description: murine inos dimer with heme, pterin and inhibitor ar-c120011

PDB Compounds: (B:) Nitric oxide synthase, inducible

SCOP Domain Sequences for d3e65b1:

Sequence; same for both SEQRES and ATOM records:

>d3e65b1 d.174.1.1 (B:77-497) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
n

Timeline for d3e65b1:

• d3e65b1 is new in SCOP 1.75
  
• d3e65b1 is called d3e65b_ in SCOPe 2.01
  
• d3e65b1 appears in the current release, SCOPe 2.08, called d3e65b_