Lineage for d2dvh__ (2dvh -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45011Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 45012Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 45013Family a.3.1.1: monodomain cytochrome c [46627] (11 proteins)
  6. 45094Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (9 species)
  7. 45105Species Desulfovibrio desulfuricans [TaxId:876] [46632] (1 PDB entry)
  8. 45106Domain d2dvh__: 2dvh - [15803]

Details for d2dvh__

PDB Entry: 2dvh (more details)

PDB Description: the y64a mutant of cytochrome c553 from desulfovibrio vulgaris hildenborough, nmr, 39 structures

SCOP Domain Sequences for d2dvh__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dvh__ a.3.1.1 (-) Cytochrome c6 (synonym: cytochrome c553) {Desulfovibrio desulfuricans}
adgaalykscigchgadgskaamgsakpvkgqgaeelykkmkgyadgsyggerkammtna
vkkasdeelkaladymskl

SCOP Domain Coordinates for d2dvh__:

Click to download the PDB-style file with coordinates for d2dvh__.
(The format of our PDB-style files is described here.)

Timeline for d2dvh__: