Lineage for d2dvh__ (2dvh -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily) Superfamily a.3.1: Cytochrome c [46626] (5 families) 
Family a.3.1.1: monodomain cytochrome c [46627] (11 proteins) Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (9 species) 
Species Desulfovibrio desulfuricans [TaxId:876] [46632] (1 PDB entry) 
Domain d2dvh__: 2dvh - [15803]
Details for d2dvh__
PDB Entry: 2dvh (more details)
PDB Description: the y64a mutant of cytochrome c553 from desulfovibrio vulgaris hildenborough, nmr, 39 structures
SCOP Domain Sequences for d2dvh__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dvh__ a.3.1.1 (-) Cytochrome c6 (synonym: cytochrome c553) {Desulfovibrio desulfuricans}
adgaalykscigchgadgskaamgsakpvkgqgaeelykkmkgyadgsyggerkammtna
vkkasdeelkaladymskl
SCOP Domain Coordinates for d2dvh__:
Click to download the PDB-style file with coordinates for d2dvh__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2dvh__:
- d2dvh__ first appeared (with stable ids) in SCOP 1.55
- d2dvh__ appears in SCOP 1.59
- d2dvh__ appears in the current release, SCOPe 2.07, called d2dvha_
View in 3D