| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.4: CAP C-terminal domain-like [46796] (8 proteins) |
| Protein Chlorophenol reduction protein CprK [158268] (2 species) |
| Species Desulfitobacterium hafniense [TaxId:49338] [158270] (3 PDB entries) Uniprot Q18R04 148-227! Uniprot Q18R04 148-229 |
| Domain d3e5ud1: 3e5u D:148-227 [158028] Other proteins in same PDB: d3e5ua2, d3e5ub2, d3e5uc2, d3e5ud2 automatically matched to 3E5U A:148-227 complexed with 3c4, na, po4 |
PDB Entry: 3e5u (more details), 1.83 Å
SCOPe Domain Sequences for d3e5ud1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e5ud1 a.4.5.4 (D:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]}
nptirilrlfyelcssqgkrvgdtyeitmplsqksigeitgvhhvtvsrvlaslkrenil
dkkknkiivynlgelkhlse
Timeline for d3e5ud1: