![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
![]() | Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
![]() | Protein Chlorophenol reduction protein CprK [159314] (2 species) |
![]() | Species Desulfitobacterium hafniense [TaxId:49338] [159315] (6 PDB entries) Uniprot Q18R04 3-147! Uniprot Q18R04 9-147 |
![]() | Domain d3e5uc2: 3e5u C:9-147 [158027] Other proteins in same PDB: d3e5ua1, d3e5ub1, d3e5uc1, d3e5ud1 automated match to d3e5ua2 complexed with 3c4, na, po4 |
PDB Entry: 3e5u (more details), 1.83 Å
SCOPe Domain Sequences for d3e5uc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e5uc2 b.82.3.2 (C:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} dfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegkikldiife dgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtdedmifeifk nyltkvayyarqvaemnty
Timeline for d3e5uc2: