Lineage for d3e5ub2 (3e5u B:9-147)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962884Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 963689Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families) (S)
  5. 963695Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 963733Protein Chlorophenol reduction protein CprK [159314] (2 species)
  7. 963737Species Desulfitobacterium hafniense [TaxId:49338] [159315] (3 PDB entries)
    Uniprot Q18R04 3-147! Uniprot Q18R04 9-147
  8. 963739Domain d3e5ub2: 3e5u B:9-147 [158025]
    Other proteins in same PDB: d3e5ua1, d3e5ub1, d3e5uc1, d3e5ud1
    automatically matched to 3E5U A:9-147
    complexed with 3c4, na, po4

Details for d3e5ub2

PDB Entry: 3e5u (more details), 1.83 Å

PDB Description: ocpa complexed cprk (c200s)
PDB Compounds: (B:) Cyclic nucleotide-binding protein

SCOPe Domain Sequences for d3e5ub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e5ub2 b.82.3.2 (B:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]}
dfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegkikldiife
dgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtdedmifeifk
nyltkvayyarqvaemnty

SCOPe Domain Coordinates for d3e5ub2:

Click to download the PDB-style file with coordinates for d3e5ub2.
(The format of our PDB-style files is described here.)

Timeline for d3e5ub2: