SCOPe 2.08: Domain d3e5ub1: 3e5u B:148-226

Lineage for d3e5ub1 (3e5u B:148-226)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
contains a small beta-sheet (wing)
Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)
Protein Chlorophenol reduction protein CprK [158268] (2 species)
Species Desulfitobacterium hafniense [TaxId:49338] [158270] (6 PDB entries)
Uniprot Q18R04 148-227! Uniprot Q18R04 148-229
Domain d3e5ub1: 3e5u B:148-226 [158024]
Other proteins in same PDB: d3e5ua2, d3e5ub2, d3e5uc2, d3e5ud2
automated match to d3e5ua1
complexed with 3c4, na, po4

Details for d3e5ub1

PDB Entry: 3e5u (more details), 1.83 Å

PDB Description: ocpa complexed cprk (c200s)

PDB Compounds: (B:) Cyclic nucleotide-binding protein

SCOPe Domain Sequences for d3e5ub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e5ub1 a.4.5.4 (B:148-226) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]}
nptirilrlfyelcssqgkrvgdtyeitmplsqksigeitgvhhvtvsrvlaslkrenil
dkkknkiivynlgelkhls

SCOPe Domain Coordinates for d3e5ub1:

Click to download the PDB-style file with coordinates for d3e5ub1.
(The format of our PDB-style files is described here.)

Timeline for d3e5ub1: