Lineage for d3e47u_ (3e47 U:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993333Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2993498Domain d3e47u_: 3e47 U: [158016]
    Other proteins in same PDB: d3e471_, d3e472_, d3e47a_, d3e47b_, d3e47c_, d3e47e_, d3e47f_, d3e47h_, d3e47i_, d3e47j_, d3e47k_, d3e47l_, d3e47m_, d3e47n_, d3e47o_, d3e47p_, d3e47q_, d3e47s_, d3e47t_, d3e47v_, d3e47w_, d3e47x_, d3e47y_, d3e47z_
    automated match to d1rypa_
    complexed with esy

Details for d3e47u_

PDB Entry: 3e47 (more details), 3 Å

PDB Description: Crystal Structure of the Yeast 20S Proteasome in Complex with Homobelactosin C
PDB Compounds: (U:) Proteasome component C7-alpha

SCOPe Domain Sequences for d3e47u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e47u_ d.153.1.4 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d3e47u_:

Click to download the PDB-style file with coordinates for d3e47u_.
(The format of our PDB-style files is described here.)

Timeline for d3e47u_: