Lineage for d1c53__ (1c53 -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 985Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 986Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 987Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins)
  6. 1061Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (7 species)
  7. 1072Species Desulfovibrio vulgaris, different strains [TaxId:881] [46631] (2 PDB entries)
  8. 1073Domain d1c53__: 1c53 - [15801]

Details for d1c53__

PDB Entry: 1c53 (more details), 1.8 Å

PDB Description: s-class cytochromes c have a variety of folding patterns: structure of cytochrome c-553 from desulfovibrio vulgaris determined by the multi-wavelength anomalous dispersion method

SCOP Domain Sequences for d1c53__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c53__ a.3.1.1 (-) Cytochrome c6 (synonym: cytochrome c553) {Desulfovibrio vulgaris, different strains}
adgaalykscvgchgadgskqamgvghavkgqkadelfkklkgyadgsyggekkavmtnl
vkrysdeemkamadymskl

SCOP Domain Coordinates for d1c53__:

Click to download the PDB-style file with coordinates for d1c53__.
(The format of our PDB-style files is described here.)

Timeline for d1c53__: