Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain [143063] (2 species) ubc1 homologue; also contains the C-terminal UBA domain |
Species Human (Homo sapiens) [TaxId:9606] [143064] (7 PDB entries) Uniprot P61086 1-156 |
Domain d3e46a2: 3e46 A:1-156 [157995] Other proteins in same PDB: d3e46a1, d3e46a3 complexed with ca; mutant |
PDB Entry: 3e46 (more details), 1.86 Å
SCOPe Domain Sequences for d3e46a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e46a2 d.20.1.1 (A:1-156) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Human (Homo sapiens) [TaxId: 9606]} maniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryqlei kipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqallaaa epddpqdavvanqykqnpemfkqtarlwahvyagap
Timeline for d3e46a2: