Class a: All alpha proteins [46456] (289 folds) |
Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
Superfamily a.5.2: UBA-like [46934] (5 families) |
Family a.5.2.1: UBA domain [46935] (25 proteins) |
Protein Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain [140327] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [140328] (7 PDB entries) Uniprot P61086 157-198 |
Domain d3e46a1: 3e46 A:157-200 [157994] Other proteins in same PDB: d3e46a2, d3e46a3 complexed with ca; mutant |
PDB Entry: 3e46 (more details), 1.86 Å
SCOPe Domain Sequences for d3e46a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e46a1 a.5.2.1 (A:157-200) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} vsspeytkkienlcaagfdrnavivalsskswdvetatelllsn
Timeline for d3e46a1: