SCOP 1.75: Domain d3e46a1: 3e46 A:157-198

Lineage for d3e46a1 (3e46 A:157-198)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (4 families)

5. Family a.5.2.1: UBA domain [46935] (24 proteins)

6. Protein Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain [140327] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140328] (3 PDB entries)
   Uniprot P61086 157-198

8. Domain d3e46a1: 3e46 A:157-198 [157994]
   Other proteins in same PDB: d3e46a2
   automatically matched to d1ylaa1
   complexed with ca; mutant

Details for d3e46a1

PDB Entry: 3e46, 1.86 Å

PDB Description: crystal structure of ubiquitin-conjugating enzyme e2-25kda (huntington interacting protein 2) m172a mutant

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2-25 kDa

SCOP Domain Sequences for d3e46a1:

Sequence; same for both SEQRES and ATOM records:

>d3e46a1 a.5.2.1 (A:157-198) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vsspeytkkienlcaagfdrnavivalsskswdvetatelll

Timeline for d3e46a1:

• d3e46a1 is new in SCOP 1.75
  
• d3e46a1 appears in SCOPe 2.01
  
• d3e46a1 appears in the current release, SCOPe 2.08