SCOPe 2.05: Domain d3e3kc_: 3e3k C:

Lineage for d3e3kc_ (3e3k C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)

6. Protein Nickel-binding periplasmic protein NikA [102694] (2 species)
   similar domain organization to oligo- and dipeptide-binding protein

7. Species Escherichia coli [TaxId:562] [102695] (18 PDB entries)

8. Domain d3e3kc_: 3e3k C: [157993]
   automated match to d1zlqa1
   complexed with act, cl, gol, hct, so4

Details for d3e3kc_

PDB Entry: 3e3k, 2.8 Å

PDB Description: Structural characterization of a putative endogenous metal chelator in the periplasmic nickel transporter NikA (butane-1,2,4-tricarboxylate without nickel form)

PDB Compounds: (C:) Nickel-binding periplasmic protein

SCOPe Domain Sequences for d3e3kc_:

Sequence; same for both SEQRES and ATOM records:

>d3e3kc_ c.94.1.1 (C:) Nickel-binding periplasmic protein NikA {Escherichia coli [TaxId: 562]}
apdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgk
twtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqit
lksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrn
enywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtq
lsqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpya
nlglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiq
admrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqa
qqgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelg
nipyapiateipfeqikp

Timeline for d3e3kc_:

• d3e3kc_ first appeared in SCOP 1.75, called d3e3kc1
  
• d3e3kc_ appears in SCOPe 2.04
  
• d3e3kc_ appears in SCOPe 2.06
  
• d3e3kc_ appears in the current release, SCOPe 2.08