SCOP 1.75: Domain d3e3ka1: 3e3k A:3-499

Lineage for d3e3ka1 (3e3k A:3-499)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)

6. Protein Nickel-binding periplasmic protein NikA [102694] (1 species)
   similar domain organization to oligo- and dipeptide-binding protein

7. Species Escherichia coli [TaxId:562] [102695] (5 PDB entries)

8. Domain d3e3ka1: 3e3k A:3-499 [157991]
   automatically matched to d1zlqa1
   complexed with act, cl, gol, hct, so4

Details for d3e3ka1

PDB Entry: 3e3k, 2.8 Å

PDB Description: Structural characterization of a putative endogenous metal chelator in the periplasmic nickel transporter NikA (butane-1,2,4-tricarboxylate without nickel form)

PDB Compounds: (A:) Nickel-binding periplasmic protein

SCOP Domain Sequences for d3e3ka1:

Sequence; same for both SEQRES and ATOM records:

>d3e3ka1 c.94.1.1 (A:3-499) Nickel-binding periplasmic protein NikA {Escherichia coli [TaxId: 562]}
pdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgkt
wtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqitl
ksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrne
nywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtql
sqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpyan
lglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiqa
dmrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqaq
qgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelgn
ipyapiateipfeqikp

Timeline for d3e3ka1:

• d3e3ka1 is new in SCOP 1.75
  
• d3e3ka1 is called d3e3ka_ in SCOPe 2.01
  
• d3e3ka1 appears in the current release, SCOPe 2.08, called d3e3ka_