SCOPe 2.06: Domain d3e2ba_: 3e2b A:

Lineage for d3e2ba_ (3e2b A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.39: DLC [54647] (1 superfamily)
   core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342

4. Superfamily d.39.1: DLC [54648] (1 family)
   automatically mapped to Pfam PF01221

5. Family d.39.1.1: DLC [54649] (3 proteins)
   8 kDa dynein light chain, DLC8

6. Protein Dynein light chain 1 (DLC1) [54650] (3 species)
   synonym: PIN, a protein inhibitor of neuronal nitric oxide synthase

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102918] (11 PDB entries)

8. Domain d3e2ba_: 3e2b A: [157988]
   automated match to d1rhwa_
   complexed with act

Details for d3e2ba_

PDB Entry: 3e2b, 2 Å

PDB Description: Crystal structure of Dynein Light chain LC8 in complex with a peptide derived from Swallow

PDB Compounds: (A:) Dynein light chain 1, cytoplasmic

SCOPe Domain Sequences for d3e2ba_:

Sequence; same for both SEQRES and ATOM records:

>d3e2ba_ d.39.1.1 (A:) Dynein light chain 1 (DLC1) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
drkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnf
gsyvthetrhfiyfylgqvaillfksg

Timeline for d3e2ba_:

• d3e2ba_ first appeared in SCOP 1.75, called d3e2ba1
  
• d3e2ba_ appears in SCOPe 2.05
  
• d3e2ba_ appears in SCOPe 2.07
  
• d3e2ba_ appears in the current release, SCOPe 2.08