SCOP 1.75: Domain d3e2ba1: 3e2b A:3-89

Lineage for d3e2ba1 (3e2b A:3-89)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.39: DLC [54647] (1 superfamily)
   core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342

4. Superfamily d.39.1: DLC [54648] (1 family)

5. Family d.39.1.1: DLC [54649] (2 proteins)
   8 kDa dynein light chain, DLC8

6. Protein Dynein light chain 1 (DLC1) [54650] (3 species)
   synonym: PIN, a protein inhibitor of neuronal nitric oxide synthase

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102918] (4 PDB entries)

8. Domain d3e2ba1: 3e2b A:3-89 [157988]
   automatically matched to d1rhwa_
   complexed with act

Details for d3e2ba1

PDB Entry: 3e2b, 2 Å

PDB Description: Crystal structure of Dynein Light chain LC8 in complex with a peptide derived from Swallow

PDB Compounds: (A:) Dynein light chain 1, cytoplasmic

SCOP Domain Sequences for d3e2ba1:

Sequence; same for both SEQRES and ATOM records:

>d3e2ba1 d.39.1.1 (A:3-89) Dynein light chain 1 (DLC1) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
drkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnf
gsyvthetrhfiyfylgqvaillfksg

Timeline for d3e2ba1:

• d3e2ba1 is new in SCOP 1.75
  
• d3e2ba1 is called d3e2ba_ in SCOPe 2.01
  
• d3e2ba1 appears in the current release, SCOPe 2.08, called d3e2ba_