Lineage for d3e1km1 (3e1k M:14-154,M:374-457)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2843543Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2843716Protein Galactose/lactose metabolism regulatory protein GAL80 [141921] (1 species)
  7. 2843717Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [141922] (2 PDB entries)
    Uniprot Q06433 2-154,374-457
  8. 2843725Domain d3e1km1: 3e1k M:14-154,M:374-457 [157983]
    Other proteins in same PDB: d3e1ka2, d3e1ka3, d3e1kc2, d3e1ke2, d3e1kg2, d3e1ki2, d3e1kk2, d3e1km2, d3e1ko2
    automatically matched to d2nvwa1
    protein/DNA complex

    has additional insertions and/or extensions that are not grouped together

Details for d3e1km1

PDB Entry: 3e1k (more details), 3 Å

PDB Description: crystal structure of kluyveromyces lactis gal80p in complex with the acidic activation domain of gal4p
PDB Compounds: (M:) Galactose/lactose metabolism regulatory protein GAL80

SCOPe Domain Sequences for d3e1km1:

Sequence, based on SEQRES records: (download)

>d3e1km1 c.2.1.3 (M:14-154,M:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
ssrpirvgfvgltsgkswvakthflaiqqlssqfqivalynptlksslqtieqlqlkhat
gfdslesfaqykdidmivvsvkvpehyevvknilehssqnlnlrylyvewalaasvqqae
elysisqqranlqtiiclqgrXynsvvgnilriyesiadyhflgkpeskssrgpddlfas
tkfdkqgfrfegfptfkdaiilhrlidavfrsdkeektldvskimi

Sequence, based on observed residues (ATOM records): (download)

>d3e1km1 c.2.1.3 (M:14-154,M:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
ssrpirvgfvgltsgkswvakthflaiqqlssqfqivalynptlksslqtieqlqlkhat
gfdslesfaqykdidmivvsvkvpehyevvknilehssqnlnlrylyvewalaasvqqae
elysisqqranlqtiiclqgrXynsvvgnilriyesiadyhflkfdkqgfrfegfptfkd
aiilhrlidavfrsdkeektldvskimi

SCOPe Domain Coordinates for d3e1km1:

Click to download the PDB-style file with coordinates for d3e1km1.
(The format of our PDB-style files is described here.)

Timeline for d3e1km1: