SCOPe 2.08: Domain d3e1ki2: 3e1k I:155-373

Lineage for d3e1ki2 (3e1k I:155-373)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins)
   has many additional secondary structures

6. Protein Galactose/lactose metabolism regulatory protein GAL80 [143546] (1 species)

7. Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [143547] (2 PDB entries)
   Uniprot Q06433 155-373

8. Domain d3e1ki2: 3e1k I:155-373 [157980]
   Other proteins in same PDB: d3e1ka1, d3e1ka3, d3e1kc1, d3e1ke1, d3e1kg1, d3e1ki1, d3e1kk1, d3e1km1, d3e1ko1
   automatically matched to d2nvwa2
   protein/DNA complex

Details for d3e1ki2

PDB Entry: 3e1k, 3 Å

PDB Description: crystal structure of kluyveromyces lactis gal80p in complex with the acidic activation domain of gal4p

PDB Compounds: (I:) Galactose/lactose metabolism regulatory protein GAL80

SCOPe Domain Sequences for d3e1ki2:

Sequence, based on SEQRES records:

>d3e1ki2 d.81.1.5 (I:155-373) Galactose/lactose metabolism regulatory protein GAL80 {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
kspyivrakelisegcigdinsieisgnggwygyerpmrspeylydiesgvnlisnsfgh
tidvlqyitgsyfqkinamisnniptqflldengkrtketisktcpdhllfqgilengkv
pvscsfkggtpvkkltknlvidihgtkgdlkiegdagfveisnlvlyfygikngngssng
tdnngaaaikdkekvtkspspstgtseeeqtmevfhlrn

Sequence, based on observed residues (ATOM records):

>d3e1ki2 d.81.1.5 (I:155-373) Galactose/lactose metabolism regulatory protein GAL80 {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
kspyivrakelisegcigdinsieisgnggwygyerpmrspeylydiesgvnlisnsfgh
tidvlqyitgsyfqkinamisnniptqflldengkrtketisktcpdhllfqgilengkv
pvscsfkggtpvkkltknlvidihgtkgdlkiegdagfveisnlvlyfygikngeeqtme
vfhlrn

Timeline for d3e1ki2:

• d3e1ki2 first appeared in SCOP 1.75
  
• d3e1ki2 appears in SCOPe 2.07